SCOPe 2.08: Domain d1nyec1: 1nye C:421-563

Lineage for d1nyec1 (1nye C:421-563)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)

6. Protein Osmotically inducible protein OsmC [103271] (1 species)

7. Species Escherichia coli [TaxId:562] [103272] (2 PDB entries)

8. Domain d1nyec1: 1nye C:421-563 [92340]
   Other proteins in same PDB: d1nyec2, d1nyed2, d1nyee2, d1nyef2
   structural genomics

Details for d1nyec1

PDB Entry: 1nye, 2.4 Å

PDB Description: Crystal structure of OsmC from E. coli

PDB Compounds: (C:) Osmotically inducible protein C

SCOPe Domain Sequences for d1nyec1:

Sequence; same for both SEQRES and ATOM records:

>d1nyec1 d.227.1.1 (C:421-563) Osmotically inducible protein OsmC {Escherichia coli [TaxId: 562]}
mtihkkgqahwegdikrgkgtvstesgvlnqqpygfntrfegekgtnpeeligaahaacf
smalslmlgeagftptsidttadvsldkvdagfaitkialksevavpgidastfdgiiqk
akagcpvsqvlkaeitldyqlks

Timeline for d1nyec1:

• d1nyec1 first appeared in SCOP 1.67, called d1nyec_
  
• d1nyec1 appears in SCOPe 2.07