SCOPe 2.06: Domain d1nycb1: 1nyc B:1-109

Lineage for d1nycb1 (1nyc B:1-109)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families)

5. Family b.61.2.2: Staphostatin [101869] (2 proteins)
   cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand

6. Protein Staphostatin B (SspC) [101872] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)

8. Domain d1nycb1: 1nyc B:1-109 [92337]
   Other proteins in same PDB: d1nyca2, d1nycb2
   complexed with cl, so4

Details for d1nycb1

PDB Entry: 1nyc, 1.4 Å

PDB Description: Staphostatins resemble lipocalins, not cystatins in fold.

PDB Compounds: (B:) cysteine protease Inhibitor

SCOPe Domain Sequences for d1nycb1:

Sequence; same for both SEQRES and ATOM records:

>d1nycb1 b.61.2.2 (B:1-109) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

Timeline for d1nycb1:

• d1nycb1 first appeared in SCOP 1.67, called d1nycb_
  
• d1nycb1 was called d1nycb_ in SCOPe 2.05
  
• d1nycb1 appears in SCOPe 2.07
  
• d1nycb1 appears in the current release, SCOPe 2.08