Lineage for d1nyca_ (1nyc A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meander
Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families) 
Family b.61.2.2: Staphostatin [101869] (2 proteins)
cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strandProtein Staphostatin B (SspC) [101872] (1 species) Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries) 
Domain d1nyca_: 1nyc A: [92336]
complexed with cl, so4
Details for d1nyca_
PDB Entry: 1nyc (more details), 1.4 Å
PDB Description: Staphostatins resemble lipocalins, not cystatins in fold.
PDB Compounds: (A:) cysteine protease InhibitorSCOPe Domain Sequences for d1nyca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyca_ b.61.2.2 (A:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
SCOPe Domain Coordinates for d1nyca_:
Click to download the PDB-style file with coordinates for d1nyca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nyca_:
- d1nyca_ first appeared in SCOP 1.67
- d1nyca_ appears in SCOPe 2.04
- d1nyca_ is called d1nyca1 in SCOPe 2.06
- d1nyca_ appears in the current release, SCOPe 2.08, called d1nyca1
View in 3D
