Lineage for d1ny6i_ (1ny6 I:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849478Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species)
  7. 1849479Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries)
  8. 1849490Domain d1ny6i_: 1ny6 I: [92329]
    AAA+ domain only in the active state
    complexed with adp

Details for d1ny6i_

PDB Entry: 1ny6 (more details), 3.1 Å

PDB Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the active state
PDB Compounds: (I:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d1ny6i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny6i_ c.37.1.20 (I:) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclv

SCOPe Domain Coordinates for d1ny6i_:

Click to download the PDB-style file with coordinates for d1ny6i_.
(The format of our PDB-style files is described here.)

Timeline for d1ny6i_: