Lineage for d1ny6c_ (1ny6 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394970Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 395139Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species)
  7. 395140Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries)
  8. 395145Domain d1ny6c_: 1ny6 C: [92323]

Details for d1ny6c_

PDB Entry: 1ny6 (more details), 3.1 Å

PDB Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the active state

SCOP Domain Sequences for d1ny6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny6c_ c.37.1.20 (C:) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus}
eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv
asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie
sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked
iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid
rgelsclv

SCOP Domain Coordinates for d1ny6c_:

Click to download the PDB-style file with coordinates for d1ny6c_.
(The format of our PDB-style files is described here.)

Timeline for d1ny6c_: