SCOP 1.75: Domain d1ny5b2: 1ny5 B:138-385

Lineage for d1ny5b2 (1ny5 B:138-385)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries)

8. Domain d1ny5b2: 1ny5 B:138-385 [92320]
   Other proteins in same PDB: d1ny5a1, d1ny5b1
   inactive state
   complexed with adp, gol, mg, po4

Details for d1ny5b2

PDB Entry: 1ny5, 2.4 Å

PDB Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state

PDB Compounds: (B:) transcriptional regulator (NtrC family)

SCOP Domain Sequences for d1ny5b2:

Sequence; same for both SEQRES and ATOM records:

>d1ny5b2 c.37.1.20 (B:138-385) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclvn

Timeline for d1ny5b2:

• d1ny5b2 first appeared in SCOP 1.67
  
• d1ny5b2 appears in SCOP 1.73
  
• d1ny5b2 appears in SCOPe 2.01
  
• d1ny5b2 appears in the current release, SCOPe 2.08