SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ny5b2 (1ny5 B:138-385)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113743Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species)
  7. 2113744Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries)
  8. 2113746Domain d1ny5b2: 1ny5 B:138-385 [92320]
    Other proteins in same PDB: d1ny5a1, d1ny5b1
    inactive state
    complexed with adp, gol, mg, po4

Details for d1ny5b2

PDB Entry: 1ny5 (more details), 2.4 Å

PDB Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state
PDB Compounds: (B:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d1ny5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny5b2 c.37.1.20 (B:138-385) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclvn

SCOPe Domain Coordinates for d1ny5b2:

Click to download the PDB-style file with coordinates for d1ny5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ny5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ny5b1