Lineage for d1ny5b2 (1ny5 B:138-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871339Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species)
  7. 2871340Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries)
  8. 2871342Domain d1ny5b2: 1ny5 B:138-385 [92320]
    Other proteins in same PDB: d1ny5a1, d1ny5b1
    inactive state
    complexed with adp, gol, mg, po4

Details for d1ny5b2

PDB Entry: 1ny5 (more details), 2.4 Å

PDB Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state
PDB Compounds: (B:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d1ny5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny5b2 c.37.1.20 (B:138-385) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclvn

SCOPe Domain Coordinates for d1ny5b2:

Click to download the PDB-style file with coordinates for d1ny5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ny5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ny5b1