Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S28e [101765] (2 species) incomplete OB-fold lacking the last strand |
Species Pyrococcus horikoshii [TaxId:53953] [101766] (1 PDB entry) |
Domain d1ny4a_: 1ny4 A: [92316] structural genomics; NESG target JR19 |
PDB Entry: 1ny4 (more details)
SCOPe Domain Sequences for d1ny4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny4a_ b.40.4.5 (A:) Ribosomal protein S28e {Pyrococcus horikoshii [TaxId: 53953]} maedegypaevieiigrtgttgdvtqvkvrilegrdkgrvirrnvrgpvrvgdililret ereareiksrr
Timeline for d1ny4a_: