Lineage for d1ny4a_ (1ny4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399704Protein Ribosomal protein S28e [101765] (2 species)
    incomplete OB-fold lacking the last strand
  7. 2399707Species Pyrococcus horikoshii [TaxId:53953] [101766] (1 PDB entry)
  8. 2399708Domain d1ny4a_: 1ny4 A: [92316]
    structural genomics; NESG target JR19

Details for d1ny4a_

PDB Entry: 1ny4 (more details)

PDB Description: solution structure of the 30s ribosomal protein s28e from pyrococcus horikoshii. northeast structural genomics consortium target jr19.
PDB Compounds: (A:) 30S ribosomal protein S28E

SCOPe Domain Sequences for d1ny4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny4a_ b.40.4.5 (A:) Ribosomal protein S28e {Pyrococcus horikoshii [TaxId: 53953]}
maedegypaevieiigrtgttgdvtqvkvrilegrdkgrvirrnvrgpvrvgdililret
ereareiksrr

SCOPe Domain Coordinates for d1ny4a_:

Click to download the PDB-style file with coordinates for d1ny4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ny4a_: