Lineage for d1ny0a_ (1ny0 A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054569Protein beta-Lactamase, class A [56606] (15 species)
  7. 1054590Species Escherichia coli, TEM-1 [TaxId:562] [56607] (33 PDB entries)
  8. 1054600Domain d1ny0a_: 1ny0 A: [92314]
    complexed with k, nbf, po4; mutant

Details for d1ny0a_

PDB Entry: 1ny0 (more details), 1.75 Å

PDB Description: crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (nbf)
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1ny0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny0a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1ny0a_:

Click to download the PDB-style file with coordinates for d1ny0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ny0a_: