Lineage for d1nxkd_ (1nxk D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588367Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 2588368Species Human (Homo sapiens) [TaxId:9606] [82790] (16 PDB entries)
  8. 2588383Domain d1nxkd_: 1nxk D: [92305]
    complexed with so4, stu

Details for d1nxkd_

PDB Entry: 1nxk (more details), 2.7 Å

PDB Description: Crystal structure of staurosporine bound to MAP KAP kinase 2
PDB Compounds: (D:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d1nxkd_:

Sequence, based on SEQRES records: (download)

>d1nxkd_ d.144.1.7 (D:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkar
revelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftere
aseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsltt
pcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmg
qyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvl

Sequence, based on observed residues (ATOM records): (download)

>d1nxkd_ d.144.1.7 (D:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkar
revelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettcytpyyvapev
lgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsev
seevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvl

SCOPe Domain Coordinates for d1nxkd_:

Click to download the PDB-style file with coordinates for d1nxkd_.
(The format of our PDB-style files is described here.)

Timeline for d1nxkd_: