Lineage for d1nx9d2 (1nx9 D:50-434)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 707349Family c.69.1.21: PepX catalytic domain-like [69581] (3 proteins)
  6. 707350Protein Alpha-amino acid ester hydrolase [89769] (2 species)
  7. 707351Species Acetobacter pasteurianus [TaxId:438] [102619] (4 PDB entries)
  8. 707355Domain d1nx9d2: 1nx9 D:50-434 [92292]
    Other proteins in same PDB: d1nx9a1, d1nx9b1, d1nx9c1, d1nx9d1
    complexed with aic, gol; mutant

Details for d1nx9d2

PDB Entry: 1nx9 (more details), 2.2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase s205a mutant complexed with ampicillin
PDB Compounds: (D:) alpha-amino acid ester hydrolase

SCOP Domain Sequences for d1nx9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx9d2 c.69.1.21 (D:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvhmptdqqrdyikrevmvpmrdgvklytvivipknarnapilltr
tpynakgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgp
lnptktdettdawdtvdwlvhnvpesngrvgmtgsayegftvvmalldphpalkvaapes
pmvdgwmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfat
qagldqypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihaw
qalkdadvkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpg
sasvhlpdaiiyntgdqkwdyyrsw

SCOP Domain Coordinates for d1nx9d2:

Click to download the PDB-style file with coordinates for d1nx9d2.
(The format of our PDB-style files is described here.)

Timeline for d1nx9d2: