SCOPe 2.08: Domain d1nx9a2: 1nx9 A:50-434

Lineage for d1nx9a2 (1nx9 A:50-434)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)

6. Protein Alpha-amino acid ester hydrolase [89769] (2 species)

7. Species Acetobacter pasteurianus [TaxId:438] [102619] (4 PDB entries)

8. Domain d1nx9a2: 1nx9 A:50-434 [92286]
   Other proteins in same PDB: d1nx9a1, d1nx9b1, d1nx9c1, d1nx9d1
   complexed with aic, gol; mutant

Details for d1nx9a2

PDB Entry: 1nx9, 2.2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase s205a mutant complexed with ampicillin

PDB Compounds: (A:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1nx9a2:

Sequence; same for both SEQRES and ATOM records:

>d1nx9a2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvhmptdqqrdyikrevmvpmrdgvklytvivipknarnapilltr
tpynakgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgp
lnptktdettdawdtvdwlvhnvpesngrvgmtgsayegftvvmalldphpalkvaapes
pmvdgwmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfat
qagldqypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihaw
qalkdadvkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpg
sasvhlpdaiiyntgdqkwdyyrsw

Timeline for d1nx9a2:

• d1nx9a2 first appeared in SCOP 1.67
  
• d1nx9a2 appears in SCOPe 2.07