Lineage for d1nx9a1 (1nx9 A:435-666)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 555113Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 555114Protein Alpha-amino acid ester hydrolase [89247] (2 species)
  7. 555115Species Acetobacter pasteurianus [TaxId:438] [101591] (1 PDB entry)
  8. 555116Domain d1nx9a1: 1nx9 A:435-666 [92285]
    Other proteins in same PDB: d1nx9a2, d1nx9b2, d1nx9c2, d1nx9d2

Details for d1nx9a1

PDB Entry: 1nx9 (more details), 2.2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase s205a mutant complexed with ampicillin

SCOP Domain Sequences for d1nx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx9a1 b.18.1.13 (A:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

SCOP Domain Coordinates for d1nx9a1:

Click to download the PDB-style file with coordinates for d1nx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1nx9a1: