SCOP 1.67: Domain d1nx6a2: 1nx6 A:134-357

Lineage for d1nx6a2 (1nx6 A:134-357)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (3 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [103103] (3 PDB entries)

8. Domain d1nx6a2: 1nx6 A:134-357 [92284]
   Other proteins in same PDB: d1nx6a1
   complexed with hti, po4

Details for d1nx6a2

PDB Entry: 1nx6, 2.15 Å

PDB Description: Crystal Structure of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae as a Tetrahedral Hemithiocetal Reaction intermediate with Phosphate at 2.15 A

SCOP Domain Sequences for d1nx6a2:

Sequence; same for both SEQRES and ATOM records:

>d1nx6a2 d.81.1.1 (A:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk
ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

Timeline for d1nx6a2:

• d1nx6a2 is new in SCOP 1.67
  
• d1nx6a2 appears in SCOP 1.69
  
• d1nx6a2 appears in the current release, SCOPe 2.08