Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [47555] (7 PDB entries) |
Domain d1nx3a_: 1nx3 A: [92282] complexed with ca, isa |
PDB Entry: 1nx3 (more details), 2.45 Å
SCOPe Domain Sequences for d1nx3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nx3a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys
Timeline for d1nx3a_: