SCOPe 2.06: Domain d1nx0a_: 1nx0 A:

Lineage for d1nx0a_ (1nx0 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [47555] (7 PDB entries)

8. Domain d1nx0a_: 1nx0 A: [92277]
   complexed with calpastatin inhibitory domain c (dic) and peptide inhibitor
   complexed with ca

Details for d1nx0a_

PDB Entry: 1nx0, 2.3 Å

PDB Description: Structure of Calpain Domain 6 in Complex with Calpastatin DIC

PDB Compounds: (A:) Calcium-dependent protease, small subunit

SCOPe Domain Sequences for d1nx0a_:

Sequence; same for both SEQRES and ATOM records:

>d1nx0a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

Timeline for d1nx0a_:

• d1nx0a_ first appeared in SCOP 1.67
  
• d1nx0a_ appears in SCOPe 2.05
  
• d1nx0a_ appears in SCOPe 2.07
  
• d1nx0a_ appears in the current release, SCOPe 2.08