Lineage for d1nx0a_ (1nx0 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269674Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1269688Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 1269705Species Pig (Sus scrofa) [TaxId:9823] [47555] (6 PDB entries)
  8. 1269714Domain d1nx0a_: 1nx0 A: [92277]
    complexed with calpastatin inhibitory domain c (dic) and peptide inhibitor
    complexed with ca

Details for d1nx0a_

PDB Entry: 1nx0 (more details), 2.3 Å

PDB Description: Structure of Calpain Domain 6 in Complex with Calpastatin DIC
PDB Compounds: (A:) Calcium-dependent protease, small subunit

SCOPe Domain Sequences for d1nx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx0a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1nx0a_:

Click to download the PDB-style file with coordinates for d1nx0a_.
(The format of our PDB-style files is described here.)

Timeline for d1nx0a_: