Lineage for d1nwud1 (1nwu D:22-260,D:329-383)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385232Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 385233Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 385241Domain d1nwud1: 1nwu D:22-260,D:329-383 [92275]
    Other proteins in same PDB: d1nwua2, d1nwub2, d1nwuc2, d1nwud2
    complexed with nag

Details for d1nwud1

PDB Entry: 1nwu (more details), 2.2 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitotetraose

SCOP Domain Sequences for d1nwud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwud1 c.1.8.5 (D:22-260,D:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOP Domain Coordinates for d1nwud1:

Click to download the PDB-style file with coordinates for d1nwud1.
(The format of our PDB-style files is described here.)

Timeline for d1nwud1: