Lineage for d1nwub2 (1nwu B:261-328)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941963Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 2941964Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries)
  8. 2941970Domain d1nwub2: 1nwu B:261-328 [92272]
    Other proteins in same PDB: d1nwua1, d1nwub1, d1nwuc1, d1nwud1

Details for d1nwub2

PDB Entry: 1nwu (more details), 2.2 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitotetraose
PDB Compounds: (B:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1nwub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwub2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOPe Domain Coordinates for d1nwub2:

Click to download the PDB-style file with coordinates for d1nwub2.
(The format of our PDB-style files is described here.)

Timeline for d1nwub2: