Lineage for d1nwub1 (1nwu B:22-260,B:329-383)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831805Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 2831806Species Human (Homo sapiens) [TaxId:9606] [89483] (8 PDB entries)
  8. 2831812Domain d1nwub1: 1nwu B:22-260,B:329-383 [92271]
    Other proteins in same PDB: d1nwua2, d1nwub2, d1nwuc2, d1nwud2

Details for d1nwub1

PDB Entry: 1nwu (more details), 2.2 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitotetraose
PDB Compounds: (B:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1nwub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwub1 c.1.8.5 (B:22-260,B:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOPe Domain Coordinates for d1nwub1:

Click to download the PDB-style file with coordinates for d1nwub1.
(The format of our PDB-style files is described here.)

Timeline for d1nwub1: