Lineage for d1nwtb2 (1nwt B:261-328)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720692Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 720693Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)
  8. 720717Domain d1nwtb2: 1nwt B:261-328 [92264]
    Other proteins in same PDB: d1nwta1, d1nwtb1, d1nwtc1, d1nwtd1

Details for d1nwtb2

PDB Entry: 1nwt (more details), 2.5 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitopentaose
PDB Compounds: (B:) chitinase-3 like protein 1

SCOP Domain Sequences for d1nwtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwtb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOP Domain Coordinates for d1nwtb2:

Click to download the PDB-style file with coordinates for d1nwtb2.
(The format of our PDB-style files is described here.)

Timeline for d1nwtb2: