| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries) |
| Domain d1nwtb2: 1nwt B:261-328 [92264] Other proteins in same PDB: d1nwta1, d1nwtb1, d1nwtc1, d1nwtd1 |
PDB Entry: 1nwt (more details), 2.5 Å
SCOPe Domain Sequences for d1nwtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwtb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy
Timeline for d1nwtb2: