Lineage for d1nwsc1 (1nws C:22-260,C:329-383)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571962Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 572025Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 572026Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 572039Domain d1nwsc1: 1nws C:22-260,C:329-383 [92257]
    Other proteins in same PDB: d1nwsa2, d1nwsb2, d1nwsc2, d1nwsd2

Details for d1nwsc1

PDB Entry: 1nws (more details), 2.7 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitobiose

SCOP Domain Sequences for d1nwsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwsc1 c.1.8.5 (C:22-260,C:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOP Domain Coordinates for d1nwsc1:

Click to download the PDB-style file with coordinates for d1nwsc1.
(The format of our PDB-style files is described here.)

Timeline for d1nwsc1: