Lineage for d1nwrb2 (1nwr B:261-328)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941963Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 2941964Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries)
  8. 2941984Domain d1nwrb2: 1nwr B:261-328 [92248]
    Other proteins in same PDB: d1nwra1, d1nwrb1, d1nwrc1, d1nwrd1

Details for d1nwrb2

PDB Entry: 1nwr (more details), 2.7 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39)
PDB Compounds: (B:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1nwrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwrb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOPe Domain Coordinates for d1nwrb2:

Click to download the PDB-style file with coordinates for d1nwrb2.
(The format of our PDB-style files is described here.)

Timeline for d1nwrb2: