Lineage for d1nwrb1 (1nwr B:22-260,B:329-383)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683248Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 683327Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 683328Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 683340Domain d1nwrb1: 1nwr B:22-260,B:329-383 [92247]
    Other proteins in same PDB: d1nwra2, d1nwrb2, d1nwrc2, d1nwrd2

Details for d1nwrb1

PDB Entry: 1nwr (more details), 2.7 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39)
PDB Compounds: (B:) chitinase-3 like protein 1

SCOP Domain Sequences for d1nwrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwrb1 c.1.8.5 (B:22-260,B:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOP Domain Coordinates for d1nwrb1:

Click to download the PDB-style file with coordinates for d1nwrb1.
(The format of our PDB-style files is described here.)

Timeline for d1nwrb1: