Lineage for d1nwna_ (1nwn A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473312Protein Hemoglobin I [46464] (2 species)
  7. 1473313Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)
  8. 1473398Domain d1nwna_: 1nwn A: [92243]
    complexed with cmo, hem

Details for d1nwna_

PDB Entry: 1nwn (more details), 2.8 Å

PDB Description: crystals of co-hbi in which the structure was converted to its unligated state, and then converted back to its original co-ligated state.
PDB Compounds: (A:) Globin I

SCOPe Domain Sequences for d1nwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwna_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d1nwna_:

Click to download the PDB-style file with coordinates for d1nwna_.
(The format of our PDB-style files is described here.)

Timeline for d1nwna_: