Lineage for d1nwhb1 (1nwh B:1-133,B:358-371)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828665Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1828677Species Haemophilus influenzae [TaxId:727] [102159] (12 PDB entries)
    Uniprot P44801
  8. 1828683Domain d1nwhb1: 1nwh B:1-133,B:358-371 [92235]
    Other proteins in same PDB: d1nwha2, d1nwhb2

Details for d1nwhb1

PDB Entry: 1nwh (more details), 2 Å

PDB Description: Crystal Structure of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae as a Tetrahedral Hemithioacetal Reaction Intermediate at 2.0 A
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1nwhb1:

Sequence, based on SEQRES records: (download)

>d1nwhb1 c.2.1.3 (B:1-133,B:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
seglkkgiktfvgXaaepvrrilkqlva

Sequence, based on observed residues (ATOM records): (download)

>d1nwhb1 c.2.1.3 (B:1-133,B:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgXa
aepvrrilkqlva

SCOPe Domain Coordinates for d1nwhb1:

Click to download the PDB-style file with coordinates for d1nwhb1.
(The format of our PDB-style files is described here.)

Timeline for d1nwhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nwhb2