Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Putative uridine phosphorylase [102500] (1 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102501] (3 PDB entries) |
Domain d1nw4e_: 1nw4 E: [92227] complexed with imh, ipa, so4 |
PDB Entry: 1nw4 (more details), 2.2 Å
SCOPe Domain Sequences for d1nw4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nw4e_ c.56.2.1 (E:) Putative uridine phosphorylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat kya
Timeline for d1nw4e_: