Lineage for d1nw4d_ (1nw4 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398089Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 398090Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)
  6. 398295Protein Putative uridine phosphorylase [102500] (1 species)
  7. 398296Species Plasmodium falciparum [102501] (3 PDB entries)
  8. 398306Domain d1nw4d_: 1nw4 D: [92226]

Details for d1nw4d_

PDB Entry: 1nw4 (more details), 2.2 Å

PDB Description: crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with immh and sulfate

SCOP Domain Sequences for d1nw4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw4d_ c.56.2.1 (D:) Putative uridine phosphorylase {Plasmodium falciparum}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

SCOP Domain Coordinates for d1nw4d_:

Click to download the PDB-style file with coordinates for d1nw4d_.
(The format of our PDB-style files is described here.)

Timeline for d1nw4d_: