![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily) barrel, closed; n=6, S=12; mixed beta-sheet |
![]() | Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) ![]() dimer of non-identical beta-sheet domains |
![]() | Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins) heterodimer of two homologous chains |
![]() | Protein Large chain TOA1, C-terminal domain [88684] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101842] (1 PDB entry) |
![]() | Domain d1nvpc_: 1nvp C: [92212] Other proteins in same PDB: d1nvpa1, d1nvpa2, d1nvpb_, d1nvpd1, d1nvpd2 protein/DNA complex |
PDB Entry: 1nvp (more details), 2.1 Å
SCOPe Domain Sequences for d1nvpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nvpc_ b.56.1.1 (C:) Large chain TOA1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dtenvvvcqydkihrsknkwkfhlkdgimnlngrdyifskaigdaew
Timeline for d1nvpc_: