Lineage for d1nvpb_ (1nvp B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442200Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 442201Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) (S)
    dimer of non-identical alpha-hairpins
  5. 442202Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
    heterodimer of two homologous chains
  6. 442203Protein Large chain TOA1, N-terminal domain [88833] (2 species)
  7. 442207Species Human (Homo sapiens) [TaxId:9606] [101164] (1 PDB entry)
  8. 442208Domain d1nvpb_: 1nvp B: [92211]
    Other proteins in same PDB: d1nvpa1, d1nvpa2, d1nvpc_, d1nvpd1, d1nvpd2

Details for d1nvpb_

PDB Entry: 1nvp (more details), 2.1 Å

PDB Description: human tfiia/tbp/dna complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1nvpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvpb_ a.32.1.1 (B:) Large chain TOA1, N-terminal domain {Human (Homo sapiens)}
tvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklm

SCOP Domain Coordinates for d1nvpb_:

Click to download the PDB-style file with coordinates for d1nvpb_.
(The format of our PDB-style files is described here.)

Timeline for d1nvpb_: