Lineage for d1nvpa2 (1nvp A:253-338)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610724Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 610725Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 610726Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 610815Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)
  8. 610819Domain d1nvpa2: 1nvp A:253-338 [92210]
    Other proteins in same PDB: d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2

Details for d1nvpa2

PDB Entry: 1nvp (more details), 2.1 Å

PDB Description: human tfiia/tbp/dna complex

SCOP Domain Sequences for d1nvpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvpa2 d.129.1.1 (A:253-338) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl
tgakvraeiyeafeniypilkgfrkt

SCOP Domain Coordinates for d1nvpa2:

Click to download the PDB-style file with coordinates for d1nvpa2.
(The format of our PDB-style files is described here.)

Timeline for d1nvpa2: