Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries) |
Domain d1nvpa1: 1nvp A:159-252 [92209] Other proteins in same PDB: d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2 protein/DNA complex |
PDB Entry: 1nvp (more details), 2.1 Å
SCOPe Domain Sequences for d1nvpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nvpa1 d.129.1.1 (A:159-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk mvctgakseeqsrlaarkyarvvqklgfpakfld
Timeline for d1nvpa1:
View in 3D Domains from other chains: (mouse over for more information) d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2 |