Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (149 PDB entries) |
Domain d1nu9d_: 1nu9 D: [92202] Other proteins in same PDB: d1nu9c1, d1nu9c2, d1nu9f1, d1nu9f2 complexed with hg, imd, mcr |
PDB Entry: 1nu9 (more details), 2.2 Å
SCOP Domain Sequences for d1nu9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu9d_ b.47.1.2 (D:) Thrombin {Human (Homo sapiens)} geadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
Timeline for d1nu9d_: