Lineage for d1nu9d_ (1nu9 D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 376157Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)
  6. 376545Protein Thrombin [50531] (2 species)
  7. 376581Species Human (Homo sapiens) [TaxId:9606] [50532] (149 PDB entries)
  8. 376656Domain d1nu9d_: 1nu9 D: [92202]
    Other proteins in same PDB: d1nu9c1, d1nu9c2, d1nu9f1, d1nu9f2
    complexed with hg, imd, mcr

Details for d1nu9d_

PDB Entry: 1nu9 (more details), 2.2 Å

PDB Description: Staphylocoagulase-Prethrombin-2 complex

SCOP Domain Sequences for d1nu9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu9d_ b.47.1.2 (D:) Thrombin {Human (Homo sapiens)}
geadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc
gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOP Domain Coordinates for d1nu9d_:

Click to download the PDB-style file with coordinates for d1nu9d_.
(The format of our PDB-style files is described here.)

Timeline for d1nu9d_: