SCOP 1.69: Domain d1nu9c1: 1nu9 C:1-145

Lineage for d1nu9c1 (1nu9 C:1-145)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.6: Staphylocoagulase [101094] (1 family)
   duplication: consists of two domains of this fold

5. Family a.8.6.1: Staphylocoagulase [101095] (1 protein)

6. Protein Staphylocoagulase [101096] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101097] (2 PDB entries)

8. Domain d1nu9c1: 1nu9 C:1-145 [92200]
   Other proteins in same PDB: d1nu9a_, d1nu9d_

Details for d1nu9c1

PDB Entry: 1nu9, 2.2 Å

PDB Description: Staphylocoagulase-Prethrombin-2 complex

SCOP Domain Sequences for d1nu9c1:

Sequence; same for both SEQRES and ATOM records:

>d1nu9c1 a.8.6.1 (C:1-145) Staphylocoagulase {Staphylococcus aureus}
ivtkdyskesrvnenskygtlisdwylkgrltslesqfinalgiletyhygekeykdakd
klmtrilgedqyllerkkvqyeeykklykkykeenptskvkmktfdqytiedltmreyne
lteslksavkdfekdveiienqhhd

Timeline for d1nu9c1:

• d1nu9c1 first appeared in SCOP 1.67
  
• d1nu9c1 appears in SCOP 1.71
  
• d1nu9c1 appears in the current release, SCOPe 2.08