SCOPe 2.06: Domain d1nu7h2: 1nu7 H:146-281

Lineage for d1nu7h2 (1nu7 H:146-281)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.6: Staphylocoagulase [101094] (1 family)
   duplication: consists of two domains of this fold

5. Family a.8.6.1: Staphylocoagulase [101095] (1 protein)

6. Protein Staphylocoagulase [101096] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101097] (2 PDB entries)

8. Domain d1nu7h2: 1nu7 H:146-281 [92194]
   Other proteins in same PDB: d1nu7.1, d1nu7.2
   complexed with 0zj, hg, imd

Details for d1nu7h2

PDB Entry: 1nu7, 2.2 Å

PDB Description: Staphylocoagulase-Thrombin Complex

PDB Compounds: (H:) Staphylocoagulase

SCOPe Domain Sequences for d1nu7h2:

Sequence; same for both SEQRES and ATOM records:

>d1nu7h2 a.8.6.1 (H:146-281) Staphylocoagulase {Staphylococcus aureus [TaxId: 1280]}
lkpftdemeekatarvddlankaysvyfafvrdtqhktealelkakvdlvlgdedkphri
sneriekemikdlesiiedffietglnkpdnitsydsskhhyknhsegfealvketreav
tnandswktktvkkyg

Timeline for d1nu7h2:

• d1nu7h2 first appeared in SCOP 1.67
  
• d1nu7h2 appears in SCOPe 2.05
  
• d1nu7h2 appears in SCOPe 2.07
  
• d1nu7h2 appears in the current release, SCOPe 2.08