Lineage for d1nu5a2 (1nu5 A:1-126)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein Chlormuconate cycloisomerase [54840] (2 species)
  7. Species Pseudomonas sp. p51 [TaxId:65067] [102948] (1 PDB entry)
  8. Domain d1nu5a2: 1nu5 A:1-126 [92184]
    Other proteins in same PDB: d1nu5a1
    complexed with mn

Details for d1nu5a2

PDB Entry: 1nu5 (more details), 1.95 Å

PDB Description: crystal structure of pseudomonas sp. p51 chloromuconate lactonizing enzyme
PDB Compounds: (A:) chloromuconate cycloisomerase

SCOPe Domain Sequences for d1nu5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu5a2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]}
mkieaisttivdvptrrplqmsfttvhkqsyvivqvkagglvgigeggsvggptwgsesa
etikviidnylapllvgkdasnlsqarvlmdravtgnlsakaaidialhdlkaralnlsi
adligg

SCOPe Domain Coordinates for d1nu5a2 are not available.

Timeline for d1nu5a2:

Domains from same chain:
(mouse over for more information)
d1nu5a1