Lineage for d1nu1k_ (1nu1 K:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426178Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 426484Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 426485Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)
  6. 426486Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 426487Species Cow (Bos taurus) [TaxId:9913] [81515] (9 PDB entries)
  8. 426494Domain d1nu1k_: 1nu1 K: [92182]
    Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_
    complexed with fes, hem, qno

Details for d1nu1k_

PDB Entry: 1nu1 (more details), 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

SCOP Domain Sequences for d1nu1k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu1k_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

SCOP Domain Coordinates for d1nu1k_:

Click to download the PDB-style file with coordinates for d1nu1k_.
(The format of our PDB-style files is described here.)

Timeline for d1nu1k_: