Lineage for d1nu1h_ (1nu1 H:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426805Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 426806Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 426807Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 426808Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 426819Species Cow (Bos taurus) [TaxId:9913] [81526] (9 PDB entries)
  8. 426826Domain d1nu1h_: 1nu1 H: [92179]
    Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1i_, d1nu1j_, d1nu1k_
    complexed with fes, hem, qno

Details for d1nu1h_

PDB Entry: 1nu1 (more details), 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

SCOP Domain Sequences for d1nu1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu1h_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc
vahklfnslk

SCOP Domain Coordinates for d1nu1h_:

Click to download the PDB-style file with coordinates for d1nu1h_.
(The format of our PDB-style files is described here.)

Timeline for d1nu1h_: