Lineage for d1nu1d2 (1nu1 D:196-241)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059826Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 1059827Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 1059828Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 1059844Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)
    Uniprot P00125
  8. 1059862Domain d1nu1d2: 1nu1 D:196-241 [92174]
    Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_
    complexed with fes, hem, qno

Details for d1nu1d2

PDB Entry: 1nu1 (more details), 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)
PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1nu1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu1d2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1nu1d2:

Click to download the PDB-style file with coordinates for d1nu1d2.
(The format of our PDB-style files is described here.)

Timeline for d1nu1d2: