Lineage for d1nu1d1 (1nu1 D:1-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304893Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2304894Protein Cytochrome bc1 domain [46677] (4 species)
  7. 2304910Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
    Uniprot P00125
  8. 2304928Domain d1nu1d1: 1nu1 D:1-195 [92173]
    Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_
    complexed with fes, hem, qno

Details for d1nu1d1

PDB Entry: 1nu1 (more details), 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)
PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1nu1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu1d1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1nu1d1:

Click to download the PDB-style file with coordinates for d1nu1d1.
(The format of our PDB-style files is described here.)

Timeline for d1nu1d1: