SCOPe 2.06: Domain d1nu1d1: 1nu1 D:1-195

Lineage for d1nu1d1 (1nu1 D:1-195)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
   Uniprot P00125

8. Domain d1nu1d1: 1nu1 D:1-195 [92173]
   Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_
   complexed with fes, hem, qno

Details for d1nu1d1

PDB Entry: 1nu1, 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1nu1d1:

Sequence; same for both SEQRES and ATOM records:

>d1nu1d1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d1nu1d1:

• d1nu1d1 first appeared in SCOP 1.67
  
• d1nu1d1 appears in SCOPe 2.05
  
• d1nu1d1 appears in SCOPe 2.07
  
• d1nu1d1 appears in the current release, SCOPe 2.08