Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries) |
Domain d1nu1c2: 1nu1 C:2-260 [92172] Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_ complexed with fes, hem, qno |
PDB Entry: 1nu1 (more details), 3.2 Å
SCOP Domain Sequences for d1nu1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu1c2 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml lvlfapdllgdpdnytpan
Timeline for d1nu1c2: