SCOP 1.67: Domain d1ntzj_: 1ntz J:

Lineage for d1ntzj_ (1ntz J:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (9 PDB entries)

8. Domain d1ntzj_: 1ntz J: [92163]
   Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzk_
   complexed with fes, hem, uq2

Details for d1ntzj_

PDB Entry: 1ntz, 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

SCOP Domain Sequences for d1ntzj_:

Sequence; same for both SEQRES and ATOM records:

>d1ntzj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
n

Timeline for d1ntzj_:

• d1ntzj_ is new in SCOP 1.67
  
• d1ntzj_ appears in SCOP 1.69
  
• d1ntzj_ appears in the current release, SCOPe 2.08