Lineage for d1ntzh_ (1ntz H:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426805Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 426806Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 426807Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 426808Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 426819Species Cow (Bos taurus) [TaxId:9913] [81526] (9 PDB entries)
  8. 426821Domain d1ntzh_: 1ntz H: [92161]
    Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzi_, d1ntzj_, d1ntzk_
    complexed with fes, hem, uq2

Details for d1ntzh_

PDB Entry: 1ntz (more details), 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

SCOP Domain Sequences for d1ntzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntzh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc
vahklfnslk

SCOP Domain Coordinates for d1ntzh_:

Click to download the PDB-style file with coordinates for d1ntzh_.
(The format of our PDB-style files is described here.)

Timeline for d1ntzh_: