Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) automatically mapped to Pfam PF02939 |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
Species Cow (Bos taurus) [TaxId:9913] [81503] (19 PDB entries) Uniprot P13271 #SP ! Uniprot P13271 |
Domain d1ntzg_: 1ntz G: [92160] Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_ complexed with fes, hem, uq2 |
PDB Entry: 1ntz (more details), 2.6 Å
SCOPe Domain Sequences for d1ntzg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntzg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpa
Timeline for d1ntzg_: