SCOPe 2.06: Domain d1ntzg_: 1ntz G:

Lineage for d1ntzg_ (1ntz G:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (19 PDB entries)
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d1ntzg_: 1ntz G: [92160]
   Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_
   complexed with fes, hem, uq2

Details for d1ntzg_

PDB Entry: 1ntz, 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1ntzg_:

Sequence; same for both SEQRES and ATOM records:

>d1ntzg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

Timeline for d1ntzg_:

• d1ntzg_ first appeared in SCOP 1.67
  
• d1ntzg_ appears in SCOPe 2.05
  
• d1ntzg_ appears in SCOPe 2.07
  
• d1ntzg_ appears in the current release, SCOPe 2.08