Class a: All alpha proteins [46456] (285 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein Cytochrome bc1 domain [46677] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [46678] (17 PDB entries) Uniprot P00125 |
Domain d1ntzd1: 1ntz D:1-195 [92155] Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_ complexed with fes, hem, uq2 |
PDB Entry: 1ntz (more details), 2.6 Å
SCOPe Domain Sequences for d1ntzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntzd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d1ntzd1: