Lineage for d1ntoe1 (1nto E:1-143,E:314-347)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558165Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 558169Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82080] (4 PDB entries)
  8. 558175Domain d1ntoe1: 1nto E:1-143,E:314-347 [92145]
    Other proteins in same PDB: d1ntoa2, d1ntob2, d1ntoc2, d1ntod2, d1ntoe2, d1ntoh2

Details for d1ntoe1

PDB Entry: 1nto (more details), 1.94 Å

PDB Description: n249y mutant of alcohol dehydrogenase from the archaeon sulfolobus solfataricus-monoclinic crystal form

SCOP Domain Sequences for d1ntoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntoe1 b.35.1.2 (E:1-143,E:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus}
mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
nfdgayaeyvivphykymyklrrXvkpmitktmkleeaneaidnlenfkaigrqvlip

SCOP Domain Coordinates for d1ntoe1:

Click to download the PDB-style file with coordinates for d1ntoe1.
(The format of our PDB-style files is described here.)

Timeline for d1ntoe1: