SCOP 1.69: Domain d1ntod2: 1nto D:144-313

Lineage for d1ntod2 (1nto D:144-313)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (14 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries)

8. Domain d1ntod2: 1nto D:144-313 [92144]
   Other proteins in same PDB: d1ntoa1, d1ntob1, d1ntoc1, d1ntod1, d1ntoe1, d1ntoh1

Details for d1ntod2

PDB Entry: 1nto, 1.94 Å

PDB Description: n249y mutant of alcohol dehydrogenase from the archaeon sulfolobus solfataricus-monoclinic crystal form

SCOP Domain Sequences for d1ntod2:

Sequence; same for both SEQRES and ATOM records:

>d1ntod2 c.2.1.1 (D:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus}
lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd
vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnysektlsvypkalak
qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk

Timeline for d1ntod2:

• d1ntod2 first appeared in SCOP 1.67
  
• d1ntod2 appears in SCOP 1.71
  
• d1ntod2 appears in the current release, SCOPe 2.08