SCOPe 2.07: Domain d1ntoc1: 1nto C:1-143,C:314-347

Lineage for d1ntoc1 (1nto C:1-143,C:314-347)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Sulfolobus solfataricus [TaxId:2287] [82080] (4 PDB entries)

8. Domain d1ntoc1: 1nto C:1-143,C:314-347 [92141]
   Other proteins in same PDB: d1ntoa2, d1ntob2, d1ntoc2, d1ntod2, d1ntoe2, d1ntoh2
   complexed with zn; mutant

Details for d1ntoc1

PDB Entry: 1nto, 1.94 Å

PDB Description: n249y mutant of alcohol dehydrogenase from the archaeon sulfolobus solfataricus-monoclinic crystal form

PDB Compounds: (C:) NAD-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1ntoc1:

Sequence; same for both SEQRES and ATOM records:

>d1ntoc1 b.35.1.2 (C:1-143,C:314-347) Alcohol dehydrogenase {Sulfolobus solfataricus [TaxId: 2287]}
mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
nfdgayaeyvivphykymyklrrXvkpmitktmkleeaneaidnlenfkaigrqvlip

Timeline for d1ntoc1:

• d1ntoc1 first appeared in SCOP 1.67
  
• d1ntoc1 appears in SCOPe 2.06
  
• d1ntoc1 appears in the current release, SCOPe 2.08